BCAP/PIK3AP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23841325UL

Catalog No. NB396837

Description

BCAP/PIK3AP1 Polyclonal specifically detects BCAP/PIK3AP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BCAP/PIK3AP1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q6ZUJ8
• Gene Symbols: PIK3AP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EWQLNQKKRSESFRFQQENLKRLRDSITRRQREKQKSGKQTDLEITVPIRHSQHLPAKVEFGVYESGPRKSVIPPRTELRRGDWK
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 1810044J04Rik, B cell adaptor protein, BCAPB-cell adapter for phosphoinositide 3-kinase, B-cell phosphoinositide 3-kinase adapter protein 1, FLJ35564, phosphoinositide 3-kinase adapter protein 1, phosphoinositide-3-kinase adaptor protein 1, RP11-34E5.3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 118788
• Target Species: Human
• Isotype: IgG