BCAT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233705

Catalog No. NBP233705

Description

BCAT2 Polyclonal specifically detects BCAT2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BCAT2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: O15382
• Gene Symbols: BCAT2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHML
• Quantity: 0.1 mL
• Research Discipline: metabolism
• Gene ID (Entrez): 587
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: BCAM, BCAT(m), BCATM, BCT2EC 2.6.1.42, branched chain amino-acid transaminase 2, mitochondrial, branched chain aminotransferase 2, mitochondrial, branched-chain-amino-acid aminotransferase, mitochondrial, ECA40, Placental protein 18, PP18
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only