Bcl-xL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23826225UL

Catalog No. NB436263

Description

Bcl-xL Polyclonal specifically detects Bcl-xL in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Bcl-xL
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q07817
• Gene Symbols: BCL2L1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATG
• Quantity: 25 μL
• Research Discipline: Apoptosis, Cancer, Tumor Suppressors
• Gene ID (Entrez): 598
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Apoptosis regulator Bcl-X, bcl2-L-1, BCL2-like 1, bcl-2-like protein 1, BCLXBCL2LBcl-X, bcl-xL, BCLXL, BCL-XL/S, bcl-xS, BCLXS, DKFZp781P2092
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.