Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Bcl-xL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Bcl-xL |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Bcl-xL Polyclonal specifically detects Bcl-xL in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Bcl-xL | |
Polyclonal | |
Rabbit | |
Apoptosis, Cancer, Tumor Suppressors | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
Apoptosis regulator Bcl-X, bcl2-L-1, BCL2-like 1, bcl-2-like protein 1, BCLXBCL2LBcl-X, bcl-xL, BCLXL, BCL-XL/S, bcl-xS, BCLXS, DKFZp781P2092 | |
BCL2L1 | |
IgG | |
Affinity Purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
Q07817 | |
598 | |
This antibody was developed against a recombinant protein corresponding to amino acids: MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATG | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title