BCL6B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180434

Catalog No. NBP180434

Description

BCL6B Polyclonal specifically detects BCL6B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: BCL6B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BAZFBcl6-associated zinc finger protein, B-cell CLL/lymphoma 6 member B protein, B-cell CLL/lymphoma 6, member B, B-cell CLL/lymphoma 6, member B (zinc finger protein), ZBTB28, Zinc finger protein 62ZNF62
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 255877
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_862827
• Gene Symbols: BCL6B
• Immunogen: Synthetic peptide directed towards the C-terminal region of human BCL6B. Peptide sequence SHVRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVHYHILGGP The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Canine: 92%; Mouse: 92%; Rat: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only