Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BCMO1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310784100UL
Description
BCMO1 Polyclonal specifically detects BCMO1 in Human samples. It is validated for Western Blot.Specifications
BCMO1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
BCDO1, BCDOEC 1.14.99.36, BCMO, BCO, BCO1, beta, beta-carotene 15, 15'-dioxygenase 1, beta-carotene 15,15'-monooxygenase, beta-carotene 15,15'-monooxygenase 1, Beta-carotene dioxygenase 1, FLJ10730 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human BCMO1. Peptide sequence GNVLNMGTSIVEKGKTKYVIFKIPATVPEGKKQGKSPWKHTEVFCSIPSR | |
100 μg | |
Lipid and Metabolism | |
53630 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction