Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

beta-Catenin Antibody (CL3689), Novus Biologicals™
SDP

Catalog No. NB393094 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB393094 25 μL
NBP261628 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB393094 Supplier Novus Biologicals Supplier No. NBP26162825UL
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

beta-Catenin Monoclonal specifically detects beta-Catenin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen beta-Catenin
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL3689
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:20000 - 1:50000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:20000 - 1:50000
Formulation PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
Gene Alias beta 1 (88kD), beta-catenin, catenin (cadherin-associated protein), beta 1, 88kDa, catenin beta-1, CTNNB, DKFZp686D02253, FLJ25606, FLJ37923
Gene Symbols CTNNB1
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Cellular Markers, Cytoskeleton Markers, Extracellular Matrix, Immune System Diseases, Mucosal Immunology, Neuroscience, Signal Transduction, Stem Cell Signaling Pathway, Wnt Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 1499
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG2a
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.