Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
beta-Catenin Antibody (CL3689), Novus Biologicals™

Mouse Monoclonal Antibody
$405.00 - $671.00
Specifications
Antigen | beta-Catenin |
---|---|
Clone | CL3689 |
Dilution | Western Blot 1 μg/mL, Immunohistochemistry 1:20000 - 1:50000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:20000 - 1:50000 |
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Monoclonal |
Description
beta-Catenin Monoclonal specifically detects beta-Catenin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
beta-Catenin | |
Western Blot 1 μg/mL, Immunohistochemistry 1:20000 - 1:50000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:20000 - 1:50000 | |
Monoclonal | |
Purified | |
Cancer, Cellular Markers, Cytoskeleton Markers, Extracellular Matrix, Immune System Diseases, Mucosal Immunology, Neuroscience, Signal Transduction, Stem Cell Signaling Pathway, Wnt Signaling Pathway | |
beta 1 (88kD), beta-catenin, catenin (cadherin-associated protein), beta 1, 88kDa, catenin beta-1, CTNNB, DKFZp686D02253, FLJ25606, FLJ37923 | |
CTNNB1 | |
IgG2a | |
Protein A purified |
CL3689 | |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Mouse | |
Human | |
1499 | |
This antibody was developed against a recombinant protein corresponding to amino acids: SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title