Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

beta-Catenin Antibody (CL3689), Novus Biologicals™

Mouse Monoclonal Antibody

$405.00 - $671.00

Specifications

Antigen	beta-Catenin
Clone	CL3689
Dilution	Western Blot 1 μg/mL, Immunohistochemistry 1:20000 - 1:50000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:20000 - 1:50000
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Monoclonal

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP261628 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP261628	100 μL	Each for $671.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB393094 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP26162825UL	25 μL	Each for $405.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

beta-Catenin Monoclonal specifically detects beta-Catenin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	beta-Catenin
Dilution	Western Blot 1 μg/mL, Immunohistochemistry 1:20000 - 1:50000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:20000 - 1:50000
Classification	Monoclonal
Form	Purified
Research Discipline	Cancer, Cellular Markers, Cytoskeleton Markers, Extracellular Matrix, Immune System Diseases, Mucosal Immunology, Neuroscience, Signal Transduction, Stem Cell Signaling Pathway, Wnt Signaling Pathway
Gene Alias	beta 1 (88kD), beta-catenin, catenin (cadherin-associated protein), beta 1, 88kDa, catenin beta-1, CTNNB, DKFZp686D02253, FLJ25606, FLJ37923
Gene Symbols	CTNNB1
Isotype	IgG2a
Purification Method	Protein A purified

Clone	CL3689
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Mouse
Target Species	Human
Gene ID (Entrez)	1499
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

beta-Catenin Antibody (CL3689), Novus Biologicals™

Specifications

Description

Specifications

Documents