BIRC6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257759

Catalog No. NBP257759

Description

BIRC6 Polyclonal specifically detects BIRC6 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: BIRC6
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: APOLLON, baculoviral IAP repeat containing 6, baculoviral IAP repeat-containing 6, baculoviral IAP repeat-containing protein 6, BRUCE, FLJ13786, KIAA1289FLJ13726, Ubiquitin-conjugating BIR domain enzyme apollon, ubiquitin-conjugating BIR-domain enzyme apollon
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: BIRC6
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSTDNESCTNSELNSPLVRRTLPVLLLYSIKESDEKAGKIFSQMNNIMSKSLHDDGFTVPQIIEMELDSQEQLLLQDPPVTYIQQFADAA
• Quantity: 100 μL
• Research Discipline: Apoptosis, Cancer, Neuroscience
• Gene ID (Entrez): 57448
• Target Species: Human
• Isotype: IgG

For Research Use Only