BIVM Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP214354

Catalog No. NBP214354

Description

BIVM Polyclonal specifically detects BIVM in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BIVM
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: basic immunoglobulin-like variable motif-containing protein, basic, immunoglobulin-like variable motif containing, FLJ20159, FLJ44301, FLJ44556, MGC133326
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: BIVM
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: RSNDSGNGEHKSERKSPEENLQGAVKSFCTSASGAPLGPKGDGHYPWSCPVTHTREKIYAICSDYAFLNQATSIYKTPNPSRSPCLPDSTSLSAGNNSSRY
• Quantity: 0.1 mL
• Research Discipline: Chromatin Research
• Gene ID (Entrez): 54841
• Target Species: Human
• Isotype: IgG

For Research Use Only