BLNK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP21435625UL

Catalog No. NB404951

Description

BLNK Polyclonal specifically detects BLNK in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BLNK
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: AGM4, B cell linker protein, BASH, B-cell adapter containing a SH2 domain protein, B-cell adapter containing a Src homology 2 domain protein, B-cell linker, B-cell linker protein, BLNK-s, Cytoplasmic adapter protein, LY57, MGC111051, SLP-65BLNK-S, SLP65Ly57, Src homology 2 domain-containing leukocyte protein of 65 kDa
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: BLNK
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: HSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSS
• Quantity: 25ul
• Research Discipline: Adaptive Immunity, Immunology, Signal Transduction
• Gene ID (Entrez): 29760
• Target Species: Human
• Isotype: IgG

For Research Use Only