Blood group H inhibitor Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157016

Catalog No. NBP157016

Description

Blood group H inhibitor Polyclonal specifically detects Blood group H inhibitor in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Blood group H inhibitor
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: alpha (1,2) fucosyltransferase, Alpha(1,2)FT 1,2-alpha-L-fucosyltransferase, Blood group H alpha 2-fucosyltransferase, EC 2.4.1.69, Fucosyltransferase 1, fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase), fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, Bombayphenotype included), fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group), galactoside 2-alpha-L-fucosyltransferase 1, GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1, HHH, HSC
• Host Species: Rabbit
• Molecular Weight of Antigen: 41 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Goat: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Guinea pig: 84%; Pig: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P19526
• Gene Symbols: FUT1
• Immunogen: Synthetic peptides corresponding to FUT1 (fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)) The peptide sequence was selected from the middle region of FUT1 (NP_000139). Peptide sequence EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFL The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2523
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.