Blood group H inhibitor Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15701620UL

Catalog No. NBP15701620

Description

Blood group H inhibitor Polyclonal specifically detects Blood group H inhibitor in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Blood group H inhibitor
• Classification: Polyclonal
• Dilution: Western Blot 0.2-1 ug/ml
• Gene Accession No.: P19526
• Gene Symbols: FUT1
• Immunogen: Synthetic peptides corresponding to FUT1 (fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)) The peptide sequence was selected from the middle region of FUT1 (NP_000139). Peptide sequence EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGG
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2523
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: alpha (1,2) fucosyltransferase, Alpha(1,2)FT 1,2-alpha-L-fucosyltransferase, Blood group H alpha 2-fucosyltransferase, EC 2.4.1.69, Fucosyltransferase 1, fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase), fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, Bombayphenotype included), fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group), galactoside 2-alpha-L-fucosyltransferase 1, GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1, HHH, HSC
• Host Species: Rabbit
• Molecular Weight of Antigen: 41 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG