Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BMAL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25675425UL
Description
BMAL1 Polyclonal specifically detects BMAL1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
BMAL1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
aryl hydrocarbon receptor nuclear translocator-like, aryl hydrocarbon receptor nuclear translocator-like protein 1, basic-helix-loop-helix-PAS orphan MOP3, BHLHE5, bHLHe5brain and muscle, bHLH-PAS protein JAP3, BMAL1TIC, Brain and muscle ARNT-like 1, Class E basic helix-loop-helix protein 5, Member of PAS protein 3, member of PAS superfamily 3, MOP3BMAL1c, PAS domain-containing protein 3, PASD3MGC47515 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
ARNTL | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDE | |
25 μL | |
Cholesterol Metabolism, Chromatin Research, Circadian Rhythm, Hypoxia, Lipid and Metabolism, Neuroscience, Transcription Factors and Regulators, Vision | |
406 | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction