BMAL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP256754	Novus Biologicals NBP256754	100 μL
NB394329	Novus Biologicals NBP25675425UL	25 μL

Description

BMAL1 Polyclonal specifically detects BMAL1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: BMAL1
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cholesterol Metabolism, Chromatin Research, Circadian Rhythm, Hypoxia, Lipid and Metabolism, Neuroscience, Transcription Factors and Regulators, Vision
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 406
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDE
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: aryl hydrocarbon receptor nuclear translocator-like, aryl hydrocarbon receptor nuclear translocator-like protein 1, basic-helix-loop-helix-PAS orphan MOP3, BHLHE5, bHLHe5brain and muscle, bHLH-PAS protein JAP3, BMAL1TIC, Brain and muscle ARNT-like 1, Class E basic helix-loop-helix protein 5, Member of PAS protein 3, member of PAS superfamily 3, MOP3BMAL1c, PAS domain-containing protein 3, PASD3MGC47515
• Gene Symbols: ARNTL
• Isotype: IgG
• Purification Method: Affinity Purified

For Research Use Only