BMAL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256754

Catalog No. NBP256754

Description

BMAL1 Polyclonal specifically detects BMAL1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: BMAL1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: aryl hydrocarbon receptor nuclear translocator-like, aryl hydrocarbon receptor nuclear translocator-like protein 1, basic-helix-loop-helix-PAS orphan MOP3, BHLHE5, bHLHe5brain and muscle, bHLH-PAS protein JAP3, BMAL1TIC, Brain and muscle ARNT-like 1, Class E basic helix-loop-helix protein 5, Member of PAS protein 3, member of PAS superfamily 3, MOP3BMAL1c, PAS domain-containing protein 3, PASD3MGC47515
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ARNTL
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDE
• Quantity: 100 μL
• Research Discipline: Cholesterol Metabolism, Chromatin Research, Circadian Rhythm, Hypoxia, Lipid and Metabolism, Neuroscience, Transcription Factors and Regulators, Vision
• Gene ID (Entrez): 406
• Target Species: Human
• Isotype: IgG

For Research Use Only