BMI-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257552

Catalog No. NBP257552

Description

BMI-1 Polyclonal specifically detects BMI-1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: BMI-1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: B lymphoma Mo-MLV insertion region 1 homolog, B lymphoma Mo-MLV insertion region 1 homolog (mouse), BMI1 polycomb ring finger oncogene, FLVI2/BMI1, MGC12685, murine leukemia viral (bmi-1) oncogene homolog, PCGF4, polycomb complex protein BMI-1, polycomb group protein Bmi1, polycomb group ring finger 4, RING finger protein 51, RNF51Polycomb group RING finger protein 4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: BMI1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYE
• Quantity: 100 μL
• Research Discipline: Breast Cancer, Cancer, Cancer Stem Cells, Cell Biology, Cell Cycle and Replication, Chromatin Research, DNA Repair, DNA replication Transcription Translation and Splicing, Epigenetics, Hematopoietic Stem Cell Markers, Neuronal Stem Cell Markers, Stem Cell Markers, Transcription Factors and Regulators
• Gene ID (Entrez): 648
• Target Species: Human
• Isotype: IgG

For Research Use Only