Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA578876

Invitrogen™ BMP4 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA578876
Change view
Click to view available options
Quantity:
100 μg
Catalog No. Quantity
PIPA578876 100 μg
1 options

Catalog No. PIPA578876

Supplier: Invitrogen™ PA578876

Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Mouse Lung Tissue, Mouse Liver Tissue, HEPA whole cell, HEPG2 whole cell, HELA whole cell.

The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein.
TRUSTED_SUSTAINABILITY

Specifications

Antigen BMP4
Applications ELISA, Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene BMP4
Gene Accession No. P12644, P21275
Gene Alias BMP; BMP2B; BMP-2B; Bmp2b1; Bmp2b-1; Bmp4; Bmp-4; BOMPR4A; Bone morphogenetic protein; Bone morphogenetic protein 2B; bone morphogenetic protein 4; bone morphogenetic protein 4 preproprotein; DVR4; Dvr-4; MCOPS6; OFC11; ZYME
Gene Symbols BMP4
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-4 (293-324aa SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 12159, 652
Target Species Human, Mouse
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.