Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. BNC1 Antibody, Novus Biologicals™

BNC1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16899620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16899620 20 μL
NBP168996 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16899620 Supplier Novus Biologicals Supplier No. NBP16899620UL

Description

Rabbit Polyclonal Antibody

BNC1 Polyclonal specifically detects BNC1 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen BNC1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Alias basonuclin, basonuclin 1, BNC, BSN1, HsT19447, zinc finger protein basonuclin, zinc finger protein basonuclin-1
Gene Symbols BNC1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to Bnc1 (basonuclin 1) The peptide sequence was selected from the C terminal of Bnc1. Peptide sequence ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI.
Molecular Weight of Antigen 110 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 646
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.