Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BNIP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | BNIP1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
BNIP1 Polyclonal specifically detects BNIP1 in Human samples. It is validated for Western Blot.Specifications
BNIP1 | |
Polyclonal | |
Rabbit | |
Apoptosis | |
BCL2/adenovirus E1B 19 kDa protein-interacting protein 1, BCL2/adenovirus E1B 19kDa interacting protein 1, BCL2/adenovirus E1B 19kD-interacting protein 1, NIP1, SEC20, SEC20L, Transformation-related gene 8 protein, TRG-8, vesicle transport protein SEC20 | |
BNIP1 | |
IgG | |
30 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q12981-1 | |
662 | |
Synthetic peptides corresponding to BNIP1 (BCL2/adenovirus E1B 19kDa interacting protein 1) The peptide sequence was selected from the N terminal of BNIP1. Peptide sequence DFNSPTTPVTFSDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRK. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title