BPIFA3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23186425UL

Catalog No. NB404845

Description

BPIFA3 Polyclonal specifically detects BPIFA3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BPIFA3
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9BQP9
• Gene Symbols: BPIFA3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QPWPGLAQAHRDNKSTLARIIAQGLIKHNAESRIQNIHFGDRLNASAQVAPGLVGWLISGR
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: bA49G10.4, chromosome 20 open reading frame 71, MGC44525, short long palate, lung and nasal epithelium carcinoma associated 3, short palate, lung and nasal epithelium carcinoma-associated protein 3, SPLUNC3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 128861
• Target Species: Human
• Isotype: IgG

For Research Use Only