BPTF/FALZ Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257567

Catalog No. NBP257567

Description

BPTF/FALZ Polyclonal specifically detects BPTF/FALZ in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: BPTF/FALZ
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: bromodomain and PHD domain transcription factor, Bromodomain and PHD finger-containing transcription factor, bromodomain PHD finger transcription factor, EC 3.6.1, EC 6.2.1.5, FAC1fetal Alz-50 reactive clone 1, FALZnucleosome-remodeling factor subunit BPTF, Fetal Alz-50 clone 1 protein, Fetal Alzheimer antigennucleosome remodeling factor, large subunit, NURF301
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2186
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: BPTF
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TTIASTGQTFQITGNPVTMAGKVITKLPLPANSKIVAVNVPATQGGIVQVHQ
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only