Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BPTF/FALZ Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | BPTF/FALZ |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
BPTF/FALZ Polyclonal specifically detects BPTF/FALZ in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
BPTF/FALZ | |
Polyclonal | |
Rabbit | |
Human | |
bromodomain and PHD domain transcription factor, Bromodomain and PHD finger-containing transcription factor, bromodomain PHD finger transcription factor, EC 3.6.1, EC 6.2.1.5, FAC1fetal Alz-50 reactive clone 1, FALZnucleosome-remodeling factor subunit BPTF, Fetal Alz-50 clone 1 protein, Fetal Alzheimer antigennucleosome remodeling factor, large subunit, NURF301 | |
BPTF | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
2186 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TTIASTGQTFQITGNPVTMAGKVITKLPLPANSKIVAVNVPATQGGIVQVHQ | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title