BRAF35 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24962125UL

Catalog No. NB395592

Description

BRAF35 Polyclonal antibody specifically detects BRAF35 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: BRAF35
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: BRAF35Sox-like transcriptional factor, high-mobility group 20B, HMG domain-containing protein 2, HMG domain-containing protein HMGX2, HMGX2FLJ26127, HMGXB2member 1-related, SMARCE1R, SMARCE1-related protein
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GFVVTVKQERGEGPRAGEKGSHEEEPVKKRGWPKGKKRKKILPNGPKAPVTGYV
• Quantity: 25 μL
• Research Discipline: Apoptosis, Cancer, Cell Cycle and Replication, Tumor Suppressors
• Gene ID (Entrez): 10362
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified