Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BRAF35 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | BRAF35 |
---|---|
Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
BRAF35 Polyclonal antibody specifically detects BRAF35 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
BRAF35 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Apoptosis, Cancer, Cell Cycle and Replication, Tumor Suppressors | |
PBS (pH 7.2), 40% Glycerol | |
10362 | |
IgG | |
Immunogen affinity purified |
Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
BRAF35Sox-like transcriptional factor, high-mobility group 20B, HMG domain-containing protein 2, HMG domain-containing protein HMGX2, HMGX2FLJ26127, HMGXB2member 1-related, SMARCE1R, SMARCE1-related protein | |
This antibody was developed against a recombinant protein corresponding to amino acids: GFVVTVKQERGEGPRAGEKGSHEEEPVKKRGWPKGKKRKKILPNGPKAPVTGYV | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title