Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Breast cancer suppressor candidate 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25691925UL
Description
Breast cancer suppressor candidate 1 Polyclonal specifically detects Breast cancer suppressor candidate 1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Breast cancer suppressor candidate 1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
BCSC-1Loss of heterozygosity 11 chromosomal region 2 gene A protein, BCSC1ortholog of mouse AW551984, Breast cancer suppressor candidate 1, LOH11CR2Avon Willebrand factor A domain-containing protein 5A, loss of heterozygosity, 11, chromosomal region 2, gene A, von Willebrand factor A domain containing 5A | |
Rabbit | |
Affinity Purified | |
RUO | |
4013 | |
Human | |
Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
VWA5A | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGEDKTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGM | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction