Breast cancer suppressor candidate 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256919

Catalog No. NBP256919

Description

Breast cancer suppressor candidate 1 Polyclonal specifically detects Breast cancer suppressor candidate 1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Breast cancer suppressor candidate 1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: BCSC-1Loss of heterozygosity 11 chromosomal region 2 gene A protein, BCSC1ortholog of mouse AW551984, Breast cancer suppressor candidate 1, LOH11CR2Avon Willebrand factor A domain-containing protein 5A, loss of heterozygosity, 11, chromosomal region 2, gene A, von Willebrand factor A domain containing 5A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4013
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: VWA5A
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGEDKTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGM
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only