Learn More
Description
Specifications
Specifications
| Antigen | Breast carcinoma amplified sequence 3 |
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL |
| Formulation | PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | BCAS4/BCAS3 fusion, breast carcinoma amplified sequence 3, breast carcinoma amplified sequence 4/3 fusion protein, breast carcinoma-amplified sequence 3, DKFZp686O1527, FLJ20128, GAOB1, MAAB, metastasis associated antigen of breast cancer, MGC4973, protein Maab1 |
| Gene Symbols | BCAS3 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGSEPPLLIMIGYSDGMQVWSIPISGEAQ |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
