BRI3BP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162385

Catalog No. NBP162385

Description

BRI3BP Polyclonal specifically detects BRI3BP in Human samples. It is validated for Western Blot.

Specifications

• Antigen: BRI3BP
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BNAS1, BRI3 binding protein, BRI3-binding protein, Cervical cancer 1 proto-oncogene-binding protein KG19, cervical cancer oncogene binding protein, HCCR-1, HCCR-2, HCCRBP-1, KG19I3-binding protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 28 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Pig: 86%; Bovine: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8WY22
• Gene Symbols: BRI3BP
• Immunogen: Synthetic peptides corresponding to BRI3BP(BRI3 binding protein) The peptide sequence was selected from the C terminal of BRI3BP. Peptide sequence GFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 140707
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.