Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BRI3BP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | BRI3BP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP162385
|
Novus Biologicals
NBP162385 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP16238520
|
Novus Biologicals
NBP16238520UL |
20 μL | N/A | N/A | N/A | ||||
Description
BRI3BP Polyclonal specifically detects BRI3BP in Human samples. It is validated for Western Blot.Specifications
| BRI3BP | |
| Polyclonal | |
| Rabbit | |
| Q8WY22 | |
| 140707 | |
| Synthetic peptides corresponding to BRI3BP(BRI3 binding protein) The peptide sequence was selected from the C terminal of BRI3BP. Peptide sequence GFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| BNAS1, BRI3 binding protein, BRI3-binding protein, Cervical cancer 1 proto-oncogene-binding protein KG19, cervical cancer oncogene binding protein, HCCR-1, HCCR-2, HCCRBP-1, KG19I3-binding protein | |
| BRI3BP | |
| IgG | |
| 28 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title