Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP180042

BRM Antibody, Novus Biologicals™
SDP

Catalog No. NBP180042 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP180042 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP180042 Supplier Novus Biologicals Supplier No. NBP180042
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

BRM Polyclonal specifically detects BRM in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen BRM
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias ATP-dependent helicase SMARCA2, BAF190B, BRG1-associated factor 190B, BRMFLJ36757, EC 3.6.1, EC 3.6.4.-, global transcription activator homologous sequence, hBRMMGC74511, hSNF2a, probable global transcription activator SNF2L2, Protein brahma homolog, SNF2, SNF2/SWI2-like protein 2, SNF2A, SNF2-alpha, SNF2L2BAF190, SNF2LA, SNF2-like 2, Sth1p, subfamily a, member 2, sucrose nonfermenting 2-like protein 2, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a2, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 2, SWI2
Gene Symbols SMARCA2
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human SMARCA2. Peptide sequence VINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKY.
Molecular Weight of Antigen 32 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6595
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.