BRN4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP189934

Catalog No. NBP189934

Description

BRN4 Polyclonal specifically detects BRN4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: BRN4
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL
• Gene Alias: brain-specific homeobox/POU domain protein 4, octamer-binding transcription factor 9, OTF9, POU class 3 homeobox 4, POU domain, class 3, transcription factor 4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5456
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: POU3F4
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDH
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only