Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. BRUNOL4 Antibody, Novus Biologicals™

BRUNOL4 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15732020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15732020 20 μL
NBP157320 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15732020 Supplier Novus Biologicals Supplier No. NBP15732020UL

Description

Rabbit Polyclonal Antibody

BRUNOL4 Polyclonal specifically detects BRUNOL4 in Human samples. It is validated for Western Blot.

Specifications

Antigen BRUNOL4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. Q9BZC1
Gene Alias Bruno (Drosophila) -like 4, RNA binding protein, BRUNOL-4, BRUNOL4Bruno -like 4, RNA binding protein, bruno-like 4, RNA binding protein, bruno-like 4, RNA binding protein (Drosophila), Bruno-like protein 4, CELF-4, CUG-BP and ETR-3 like factor 4, CUG-BP- and ETR-3-like factor 4, CUGBP Elav-like family member 4, CUGBP, Elav-like family member 4, LYST-interacting protein LIP9, RNA-binding protein BRUNOL4, RNA-binding protein BRUNOL-4
Gene Symbols CELF4
Host Species Rabbit
Immunogen Synthetic peptides corresponding to BRUNOL4(bruno-like 4, RNA binding protein (Drosophila)) The peptide sequence was selected from the middle region of BRUNOL4 (NP_064565). Peptide sequence PMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPI.
Molecular Weight of Antigen 52 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 56853
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.