BRUNOL4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP18993225UL

Catalog No. NB405711

Description

BRUNOL4 Polyclonal specifically detects BRUNOL4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BRUNOL4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CELF4
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMKDH
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Concentration: 0.2mg/mL
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Bruno (Drosophila) -like 4, RNA binding protein, BRUNOL-4, BRUNOL4Bruno -like 4, RNA binding protein, bruno-like 4, RNA binding protein, bruno-like 4, RNA binding protein (Drosophila), Bruno-like protein 4, CELF-4, CUG-BP and ETR-3 like factor 4, CUG-BP- and ETR-3-like factor 4, CUGBP Elav-like family member 4, CUGBP, Elav-like family member 4, LYST-interacting protein LIP9, RNA-binding protein BRUNOL4, RNA-binding protein BRUNOL-4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56853
• Target Species: Human
• Isotype: IgG

For Research Use Only