Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BRUNOL5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP157522
Description
BRUNOL5 Polyclonal specifically detects BRUNOL5 in Human samples. It is validated for Western Blot.Specifications
| BRUNOL5 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Bruno (Drosophila) -like 5, RNA binding protein, BRUNOL-5, BRUNOL5bruno-like 5, RNA binding protein (Drosophila), bruno-like 5 RNA binding protein, Bruno-like protein 5, CELF-5, CUG-BP and ETR-3 like factor 5, CUG-BP- and ETR-3-like factor 5, CUGBP Elav-like family member 5, CUGBP, Elav-like family member 5, RNA-binding protein BRUNOL-5 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 60680 | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q8N6W0 | |
| CELF5 | |
| Synthetic peptides corresponding to BRUNOL5 (CUGBP, Elav-like family member 5) The peptide sequence was selected from the middle region of BRUNOL5)(50ug). Peptide sequence AFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLP. | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction