Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BRUNOL5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | BRUNOL5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
BRUNOL5 Polyclonal specifically detects BRUNOL5 in Human samples. It is validated for Western Blot.Specifications
| BRUNOL5 | |
| Polyclonal | |
| Rabbit | |
| Q8N6W0 | |
| 60680 | |
| Synthetic peptides corresponding to BRUNOL5 (CUGBP, Elav-like family member 5) The peptide sequence was selected from the middle region of BRUNOL5)(50ug). Peptide sequence AFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Bruno (Drosophila) -like 5, RNA binding protein, BRUNOL-5, BRUNOL5bruno-like 5, RNA binding protein (Drosophila), bruno-like 5 RNA binding protein, Bruno-like protein 5, CELF-5, CUG-BP and ETR-3 like factor 5, CUG-BP- and ETR-3-like factor 5, CUGBP Elav-like family member 5, CUGBP, Elav-like family member 5, RNA-binding protein BRUNOL-5 | |
| CELF5 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title