BTAF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257414

Catalog No. NBP257414

Description

BTAF1 Polyclonal specifically detects BTAF1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: BTAF1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: ATP-dependent helicase BTAF1, BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170kDa (Mot1homolog, S. cerevisiae), B-TFIID transcription factor-associated 170 kDa subunit, EC 3.6.1, EC 3.6.4.-, MOT1MGC138406, TAF(II)170KIAA0940, TAF-172, TAF172BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170 kD (Mot1homolog, S. cerevisiae), TAFII170TATA-binding protein-associated factor 172, TBP-associated factor 172
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9044
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: BTAF1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QFAARYGKPILASRDARSSSREQEAGVLAMDALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVDETVSSATLS
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only