BTBD14A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP230655

Catalog No. NBP230655

Description

BTBD14A Polyclonal specifically detects BTBD14A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BTBD14A
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q96BF6
• Gene Symbols: NACC2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DEEDDEAYDTMVEEQYGQMYIKASGSYAVQEKPEPVPLESRSCVLIRRDLVALPA
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: BEN domain containing 9, BEND9, BTB (POZ) domain containing 14A, BTB/POZ domain-containing protein 14A, BTBD14, BTBD14A, MGC23427, NAC2, NAC-2, NACC family member 2, BEN and BTB (POZ) domain containing, nucleus accumbens-associated protein 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 138151
• Target Species: Human
• Isotype: IgG

For Research Use Only