BTBD14A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB437482	Novus Biologicals NBP23065525UL	25 μL
NBP230655	Novus Biologicals NBP230655	0.1 mL

Description

BTBD14A Polyclonal specifically detects BTBD14A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BTBD14A
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: BEN domain containing 9, BEND9, BTB (POZ) domain containing 14A, BTB/POZ domain-containing protein 14A, BTBD14, BTBD14A, MGC23427, NAC2, NAC-2, NACC family member 2, BEN and BTB (POZ) domain containing, nucleus accumbens-associated protein 2
• Gene Symbols: NACC2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q96BF6
• Gene ID (Entrez): 138151
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DEEDDEAYDTMVEEQYGQMYIKASGSYAVQEKPEPVPLESRSCVLIRRDLVALPA
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only