Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BTG4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | BTG4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
BTG4 Polyclonal specifically detects BTG4 in Human samples. It is validated for Western Blot.Specifications
BTG4 | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication | |
B-cell translocation gene 4, BTG family member 4, MGC33003, PC3BProtein PC3b, protein BTG4 | |
BTG4 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q9NY30 | |
54766 | |
Synthetic peptides corresponding to BTG4(B-cell translocation gene 4) The peptide sequence was selected from the middle region of BTG4. Peptide sequence ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title