c-Myc Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25666025UL

Catalog No. NB394371

Description

c-Myc Polyclonal specifically detects c-Myc in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: c-Myc
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: avian myelocytomatosis viral oncogene homolog, BHLHE39, bHLHe39MRTL, Class E basic helix-loop-helix protein 39, c-Myc, MYC, myc proto-oncogene protein, MYCC, myc-related translation/localization regulatory factor, Proto-oncogene c-Myc, Transcription factor p64, v-myc avian myelocytomatosis viral oncogene homolog, v-myc myelocytomatosis viral oncogene homolog (avian)
• Host Species: Rabbit
• Molecular Weight of Antigen: 67 kDa
• Quantity: 25 μL
• Research Discipline: Autophagy, Cancer, Cancer Stem Cells, Cell Cycle and Replication, Chromatin Research, Core ESC Like Genes, Epigenetics, Tags, Stem Cell Markers, Transcription Factors and Regulators, Tumor Suppressors
• Gene ID (Entrez): 4609
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: MYC
• Immunogen: This antibody was developed against a c-Myc Antibody recombinant protein corresponding to the following amino acid sequence: QAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only