Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
c-Myc Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$393.50 - $658.00
Specifications
Antigen | c-Myc |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
c-Myc Polyclonal specifically detects c-Myc in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
c-Myc | |
Polyclonal | |
Rabbit | |
Human | |
avian myelocytomatosis viral oncogene homolog, BHLHE39, bHLHe39MRTL, Class E basic helix-loop-helix protein 39, c-Myc, MYC, myc proto-oncogene protein, MYCC, myc-related translation/localization regulatory factor, Proto-oncogene c-Myc, Transcription factor p64, v-myc avian myelocytomatosis viral oncogene homolog, v-myc myelocytomatosis viral oncogene homolog (avian) | |
MYC | |
IgG | |
Affinity Purified | |
67 kDa |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
4609 | |
This antibody was developed against a c-Myc Antibody recombinant protein corresponding to the following amino acid sequence: QAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title