Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C14orf180 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15953320UL
Description
C14orf180 Polyclonal specifically detects C14orf180 in Human samples. It is validated for Western Blot.Specifications
C14orf180 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8N912 | |
C14ORF180 | |
Synthetic peptides corresponding to C14ORF180 The peptide sequence was selected from the N terminal of C14ORF180. Peptide sequence EDNRKCPPSILKRSRPEHHRPEAKPQRTSRRVWFREPPAVTVHYIADKNA. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C14orf77, chromosome 14 open reading frame 180, chromosome 14 open reading frame 77, FLJ38594, NRAC, transmembrane protein C14orf180 | |
Rabbit | |
Affinity Purified | |
RUO | |
400258 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction