Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C14orf180 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	C14orf180
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15953320 View Documents View Product Certificates	Novus Biologicals NBP15953320UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP159533 View Documents View Product Certificates	Novus Biologicals NBP159533	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

C14orf180 Polyclonal specifically detects C14orf180 in Human samples. It is validated for Western Blot.

Specifications

Antigen	C14orf180
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Alias	C14orf77, chromosome 14 open reading frame 180, chromosome 14 open reading frame 77, FLJ38594, NRAC, transmembrane protein C14orf180
Gene Symbols	C14ORF180
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q8N912
Gene ID (Entrez)	400258
Immunogen	Synthetic peptides corresponding to C14ORF180 The peptide sequence was selected from the N terminal of C14ORF180. Peptide sequence EDNRKCPPSILKRSRPEHHRPEAKPQRTSRRVWFREPPAVTVHYIADKNA.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

C14orf180 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents