Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C17orf78 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | C17orf78 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP160078
![]() |
Novus Biologicals
NBP160078 |
100 μL |
Each for $480.74
|
|
|||||
NBP16007820
![]() |
Novus Biologicals
NBP16007820UL |
20 μL | N/A | N/A | N/A | ||||
Description
C17orf78 Polyclonal specifically detects C17orf78 in Human samples. It is validated for Western Blot.Specifications
| C17orf78 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| chromosome 17 open reading frame 78, FLJ39647, hypothetical protein LOC284099, MGC34759 | |
| C17ORF78 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8N4C9 | |
| 284099 | |
| Synthetic peptides corresponding to C17ORF78 The peptide sequence was selected from the middle region of C17ORF78. Peptide sequence LGARKLCQCQWLWRWQKKGGQPPGTAESKPDSQPQKVGQDAANSSNPKKA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title