Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. C18orf32 Antibody, Novus Biologicals™

C18orf32 Antibody, Novus Biologicals™
SDP

Catalog No. NBP156827 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156827 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP156827 Supplier Novus Biologicals Supplier No. NBP156827
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

C18orf32 Polyclonal specifically detects C18orf32 in Human samples. It is validated for Western Blot.

Specifications

Antigen C18orf32
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8TCD1
Gene Alias chromosome 18 open reading frame 32, FLJ23458, hypothetical protein LOC497661, Putative NF-kappa-B-activating protein 200, putative NFkB activating protein
Gene Symbols C18ORF32
Host Species Rabbit
Immunogen Synthetic peptides corresponding to C18ORF32 The peptide sequence was selected from the middle region of C18ORF32. Peptide sequence PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKK.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 497661
Test Specificity Expected identity based on immunogen sequence: Sumatran orangutan: 100%; Human: 100%;.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Bovine
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.