Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C1GALT1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16259620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16259620 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP16259620 Supplier Novus Biologicals Supplier No. NBP16259620UL

Rabbit Polyclonal Antibody

C1GALT1 Polyclonal specifically detects C1GALT1 in Human samples. It is validated for Western Blot.

Specifications

Antigen C1GALT1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9NS00
Gene Alias B3Gal-T8, Beta-1,3-galactosyltransferase, C1GALT, C1GalT1, Core 1 beta1,3-galactosyltransferase 1, Core 1 beta3-Gal-T1, Core 1 O-glycan T-synthase, core 1 synthase, glycoprotein-N-acetylgalactosamine3-beta-galactosyltransferase, 1, Core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta1,3-galactosyltransferase 1, EC 2.4.1.122, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1, T-synthase
Gene Symbols C1GALT1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to C1GALT1(core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1) The peptide sequence was selected form the middle region of C1GALT1. Peptide sequence NVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNY
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 56913
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.