C1QB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15905620UL

Catalog No. NBP15905620

Description

C1QB Polyclonal specifically detects C1QB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: C1QB
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Alias: B chain, complement C1q subcomponent subunit B, complement component 1, q subcomponent, B chain, complement subcomponent C1q chain B, q subcomponent, beta polypeptide
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 713
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: C1QB
• Immunogen: Synthetic peptides corresponding to C1QB(complement component 1, q subcomponent, B chain) The peptide sequence was selected from the C terminal of C1QB. Peptide sequence AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: B.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.