Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C1QB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | C1QB |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15905620
|
Novus Biologicals
NBP15905620UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159056
|
Novus Biologicals
NBP159056 |
100 μL |
Each for $487.50
|
|
|||||
Description
C1QB Polyclonal specifically detects C1QB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| C1QB | |
| Polyclonal | |
| Rabbit | |
| B chain, complement C1q subcomponent subunit B, complement component 1, q subcomponent, B chain, complement subcomponent C1q chain B, q subcomponent, beta polypeptide | |
| C1QB | |
| IgG | |
| This product is specific to Subunit or Isoform: B. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| 713 | |
| Synthetic peptides corresponding to C1QB(complement component 1, q subcomponent, B chain) The peptide sequence was selected from the C terminal of C1QB. Peptide sequence AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title