Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C1qTNF1/CTRP1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP162296 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP162296 100 μL
NBP16229620 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP162296 Supplier Novus Biologicals Supplier No. NBP162296
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

C1qTNF1/CTRP1 Polyclonal specifically detects C1qTNF1/CTRP1 in Human samples. It is validated for Western Blot.

Specifications

Antigen C1qTNF1/CTRP1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9BXJ1
Gene Alias C1q and tumor necrosis factor related protein 1, CTRP1G protein-coupled receptor-interacting protein, FLJ90694, G protein coupled receptor interacting protein, GIPcomplement C1q tumor necrosis factor-related protein 1, ZSIG37
Gene Symbols C1QTNF1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to C1QTNF1(C1q and tumor necrosis factor related protein 1) The peptide sequence was selected from the N terminal of C1QTNF1. Peptide sequence YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGS.
Molecular Weight of Antigen 23 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 114897
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.